Recombinant Human BCL6 Protein

• Cat.No.: BCL6-159H
• Product Overview: Human BCL6 partial ORF ( NP_001697, 131 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of START-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: EMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERAL
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL6 B-cell CLL/lymphoma 6 [ Homo sapiens ]
• Official Symbol: BCL6
• Synonyms: BCL6; B-cell CLL/lymphoma 6; zinc finger protein 51 , ZNF51; B-cell lymphoma 6 protein; BCL5; BCL6A; LAZ3; ZBTB27; BCL-5; BCL-6; protein LAZ-3; zinc finger protein 51; B-cell lymphoma 5 protein; B-cell lymphoma 6 protein transcript; zinc finger transcription factor BCL6S; cys-his2 zinc finger transcription factor; zinc finger and BTB domain-containing protein 27; lymphoma-associated zinc finger gene on chromosome 3; ZNF51
• Gene ID: 604
• mRNA Refseq: NM_001130845
• Protein Refseq: NP_001124317
• MIM: 109565
• UniProt ID: P41182