Recombinant Human BCL2L12 Protein, GST-tagged

• Cat.No.: BCL2L12-152H
• Product Overview: Human BCL2L12 full-length ORF ( NP_001035758.1, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a Bcl-2 homology domain 2 (BH2). The function of this gene has not yet been determined. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 63.1 kDa
• AA Sequence: MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL2L12 BCL2-like 12 (proline rich) [ Homo sapiens ]
• Official Symbol: BCL2L12
• Synonyms: BCL2L12; BCL2-like 12 (proline rich); bcl-2-like protein 12; bcl2-L-12; Bcl-2 related proline-rich protein; bcl-2-related proline-rich protein; MGC120313; MGC120314; MGC120315
• Gene ID: 83596
• mRNA Refseq: NM_001040668
• Protein Refseq: NP_001035758
• MIM: 610837
• UniProt ID: Q9HB09