Recombinant Human BCL2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BCL2-4343H |
Product Overview : | BCL2 MS Standard C13 and N15-labeled recombinant protein (NP_000624) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BCL2 B-cell CLL/lymphoma 2 [ Homo sapiens (human) ] |
Official Symbol | BCL2 |
Synonyms | BCL2; B-cell CLL/lymphoma 2; apoptosis regulator Bcl-2; Bcl 2; PPP1R50; protein phosphatase 1; regulatory subunit 50; protein phosphatase 1, regulatory subunit 50; Bcl-2; |
Gene ID | 596 |
mRNA Refseq | NM_000633 |
Protein Refseq | NP_000624 |
MIM | 151430 |
UniProt ID | P10415 |
◆ Recombinant Proteins | ||
BCL2-266H | Recombinant Human BCL2 protein, His-tagged | +Inquiry |
BCL2-6891C | Recombinant Chicken BCL2 | +Inquiry |
RFL23045HF | Recombinant Full Length Human Apoptosis Regulator Bcl-2(Bcl2) Protein, His-Tagged | +Inquiry |
BCL2-509H | Recombinant Human B-cell CLL/lymphoma 2, His-tagged | +Inquiry |
BCL2-957R | Recombinant Rat BCL2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2 Products
Required fields are marked with *
My Review for All BCL2 Products
Required fields are marked with *
0
Inquiry Basket