Recombinant Human BCKDHA, His-tagged
Cat.No. : | BCKDHA-27439TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 51-445 of Human BCKDHA with N terminal His tag; Predicted MWt 46 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 51-445 a.a. |
Description : | The branched-chain alpha-keto acid (BCAA) dehydrogenase (BCKD) complex is an innter mitochondrial enzyme complex that catalyzes the second major step in the catabolism of the branched-chain amino acids leucine, isoleucine, and valine. The BCKD complex consists of three catalytic components: a heterotetrameric (alpha2-beta2) branched-chain alpha-keto acid decarboxylase (E1), a dihydrolipoyl transacylase (E2), and a dihydrolipoamide dehydrogenase (E3). This gene encodes the alpha subunit of the decarboxylase (E1) component. Mutations in this gene result in maple syrup urine disease, type IA. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 69 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIIN PSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRI SFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMY RDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVT ISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEG DAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGD GIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAE NQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQD HPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAE RKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGE HYPLDHFDK |
Sequence Similarities : | Belongs to the BCKDHA family. |
Gene Name | BCKDHA branched chain keto acid dehydrogenase E1, alpha polypeptide [ Homo sapiens ] |
Official Symbol | BCKDHA |
Synonyms | BCKDHA; branched chain keto acid dehydrogenase E1, alpha polypeptide; 2 oxoisovalerate dehydrogenase (lipoamide) , branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urine disease) , OVD1A; 2-oxoisovalerate dehydrogenase subunit al |
Gene ID | 593 |
mRNA Refseq | NM_000709 |
Protein Refseq | NP_000700 |
MIM | 608348 |
Uniprot ID | P12694 |
Chromosome Location | 19q13.1-q13.2 |
Pathway | 2-oxobutanoate degradation I, conserved biosystem; Branched-chain amino acid catabolism, organism-specific biosystem; Leucine degradation, leucine => acetoacetate + acetyl-CoA, organism-specific biosystem; Leucine degradation, leucine => |
Function | 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity; alpha-ketoacid dehydrogenase activity; carboxy-lyase activity; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
BCKDHA-962H | Recombinant Human BCKDHA | +Inquiry |
BCKDHA-136H | Recombinant Human BCKDHA Protein, GST-tagged | +Inquiry |
BCKDHA-27439TH | Recombinant Human BCKDHA, His-tagged | +Inquiry |
BCKDHA-135H | Recombinant Human BCKDHA Protein, GST-tagged | +Inquiry |
BCKDHA-19H | Recombinant Human BCKDHA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCKDHA-163HCL | Recombinant Human BCKDHA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCKDHA Products
Required fields are marked with *
My Review for All BCKDHA Products
Required fields are marked with *
0
Inquiry Basket