Recombinant Human BCAS2 Protein, GST-tagged

• Cat.No.: BCAS2-126H
• Product Overview: Human BCAS2 partial ORF ( NP_005863, 116 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: HQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
• Purity: Glutathione Sepharose 4 Fast Flow
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCAS2 breast carcinoma amplified sequence 2 [ Homo sapiens ]
• Official Symbol: BCAS2
• Synonyms: BCAS2; breast carcinoma amplified sequence 2; pre-mRNA-splicing factor SPF27; DAM1; Snt309; SPF27; breast carcinoma-amplified sequence 2; spliceosome-associated protein SPF 27; DNA amplified in mammary carcinoma 1 protein; spliceosome associated protein, amplified in breast cancer
• Gene ID: 10286
• mRNA Refseq: NM_005872
• Protein Refseq: NP_005863
• MIM: 605783
• UniProt ID: O75934