Recombinant Human BCAR3 Protein, GST-tagged
Cat.No. : | BCAR3-122H |
Product Overview : | Human BCAR3 partial ORF ( AAH39895, 266 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.51 kDa |
AA Sequence : | YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCAR3 breast cancer anti-estrogen resistance 3 [ Homo sapiens ] |
Official Symbol | BCAR3 |
Synonyms | BCAR3; breast cancer anti-estrogen resistance 3; breast cancer anti-estrogen resistance protein 3; NSP2; SH2D3B; novel SH2-containing protein 2; SH2 domain-containing protein 3B; dJ1033H22.2 (breast cancer anti-estrogen resistance 3); KIAA0554; |
Gene ID | 8412 |
mRNA Refseq | NM_003567 |
Protein Refseq | NP_003558 |
MIM | 604704 |
UniProt ID | O75815 |
◆ Recombinant Proteins | ||
BCAR3-431H | Recombinant Human BCAR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Bcar3-1841M | Recombinant Mouse Bcar3 Protein, Myc/DDK-tagged | +Inquiry |
BCAR3-6347Z | Recombinant Zebrafish BCAR3 | +Inquiry |
BCAR3-337C | Recombinant Cynomolgus BCAR3 Protein, His-tagged | +Inquiry |
BCAR3-562H | Recombinant Human BCAR3 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAR3-8497HCL | Recombinant Human BCAR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCAR3 Products
Required fields are marked with *
My Review for All BCAR3 Products
Required fields are marked with *
0
Inquiry Basket