Recombinant Human BCAM protein, GST-tagged

• Cat.No.: BCAM-301325H
• Product Overview: Recombinant Human BCAM (569-628 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Tyr569-Cys628
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: YCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: BCAM basal cell adhesion molecule (Lutheran blood group) [ Homo sapiens ]
• Official Symbol: BCAM
• Synonyms: BCAM; basal cell adhesion molecule (Lutheran blood group); basal cell adhesion molecule (Lu and Au blood groups) , LU, Lutheran blood group (Auberger b antigen included); basal cell adhesion molecule; CD239; F8/G253 antigen; lutheran antigen; Auberger b antigen; glycoprotein 95kDa; B-cell adhesion molecule; B-CAM cell surface glycoprotein; lutheran blood group glycoprotein; antigen identified by monoclonal F8; basal cell adhesion molecule (Lu and Au blood groups); AU; LU; MSK19
• Gene ID: 4059
• mRNA Refseq: NM_001013257
• Protein Refseq: NP_001013275
• MIM: 612773
• UniProt ID: P50895