Recombinant Human BATF2 Protein, GST-tagged

• Cat.No.: BATF2-4344H
• Product Overview: Human MGC20410 full-length ORF ( AAH12330, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: BATF2 (Basic Leucine Zipper ATF-Like Transcription Factor 2) is a Protein Coding gene. Diseases associated with BATF2 include Cercarial Dermatitis. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is BATF.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 46.53 kDa
• AA Sequence: MDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BATF2 basic leucine zipper transcription factor, ATF-like 2 [ Homo sapiens ]
• Official Symbol: BATF2
• Synonyms: BATF2; basic leucine zipper transcription factor, ATF-like 2; basic leucine zipper transcriptional factor ATF-like 2; MGC20410; B-ATF-2; suppressor of AP-1 regulated by IFN; SARI
• Gene ID: 116071
• mRNA Refseq: NM_138456
• Protein Refseq: NP_612465
• UniProt ID: Q8N1L9