Recombinant Human BASP1 protein, GST-tagged

• Cat.No.: BASP1-081H
• Product Overview: Human BASP1 full-length ORF ( NP_006308.3, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in proteins with high turnover rates. Immunological characteristics of this protein are species specific. This protein also undergoes N-terminal myristoylation. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 50.6 kDa
• AA Sequence: MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAPAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPLRGGEAPKAAEAAAGPRPRAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BASP1 brain abundant, membrane attached signal protein 1 [ Homo sapiens ]
• Official Symbol: BASP1
• Synonyms: BASP1; brain abundant, membrane attached signal protein 1; brain acid soluble protein 1; CAP 23; CAP23; NAP 22; NAP22; brain acid-soluble protein 1; neuronal axonal membrane protein NAP-22; neuronal tissue-enriched acidic protein; 22 kDa neuronal tissue-enriched acidic protein; CAP-23; NAP-22; MGC8555
• Gene ID: 10409
• mRNA Refseq: NM_006317
• Protein Refseq: NP_006308
• MIM: 605940
• UniProt ID: P80723