Recombinant Human BANF1 protein, GST-tagged

• Cat.No.: BANF1-068H
• Product Overview: Human BANF1 full-length ORF ( AAH05942, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.53 kDa
• AA Sequence: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BANF1 barrier to autointegration factor 1 [ Homo sapiens ]
• Official Symbol: BANF1
• Synonyms: BANF1; barrier to autointegration factor 1; barrier-to-autointegration factor; BAF; breakpoint cluster region protein 1; NGPS; BCRP1; D14S1460; MGC111161
• Gene ID: 8815
• mRNA Refseq: NM_001143985
• Protein Refseq: NP_001137457
• MIM: 603811
• UniProt ID: O75531