Recombinant Human BAMBI protein, T7/His-tagged

Cat.No. : BAMBI-75H
Product Overview : Recombinant human BAMBI cDNA (21 – 152 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 21-152 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLT HGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQE LTSSKELWFRA
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro BAMBI protein mediated Wnt / b-catenin pathway regulation for either adipocytes or hepatocytes differentiation study with this protein as either coating matrix protein or soluble factor.2. May be used for BAMBI protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name BAMBI BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol BAMBI
Synonyms BAMBI; BMP and activin membrane-bound inhibitor homolog (Xenopus laevis); BMP and activin membrane-bound inhibitor homolog; NMA; non-metastatic gene A protein; putative transmembrane protein NMA;
Gene ID 25805
mRNA Refseq NM_012342
Protein Refseq NP_036474
MIM 604444
UniProt ID Q13145
Chromosome Location 10p12.3-p11.2
Pathway BMP receptor signaling, organism-specific biosystem; TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem;
Function frizzled binding; type II transforming growth factor beta receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BAMBI Products

Required fields are marked with *

My Review for All BAMBI Products

Required fields are marked with *

0

Inquiry Basket

cartIcon