Recombinant Human BAI3 protein, GST-tagged

• Cat.No.: BAI3-061H
• Product Overview: Human BAI3 partial ORF ( NP_001695, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This p53-target gene encodes a brain-specific angiogenesis inhibitor, a seven-span transmembrane protein, and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are similar to BAI1 in structure, have similar tissue specificities, and may also play a role in angiogenesis. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: QDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLENPDPTKYSIYLKFSKKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCNSKNAFVFLQYDKNFIQIRRVFP
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BAI3 brain-specific angiogenesis inhibitor 3 [ Homo sapiens ]
• Official Symbol: BAI3
• Gene ID: 577
• mRNA Refseq: NM_001704.2
• Protein Refseq: NP_001695.1
• MIM: 602684
• UniProt ID: O60242