Recombinant Human BAD protein, GST-tagged

Cat.No. : BAD-048H
Product Overview : Human BAD full-length ORF ( AAH01901.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 44.11 kDa
AA Sequence : MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BAD BCL2-associated agonist of cell death [ Homo sapiens ]
Official Symbol BAD
Synonyms BAD; BCL2-associated agonist of cell death; bcl2 antagonist of cell death; BBC2; BCL2L8; bcl2-L-8; BCL2-binding protein; bcl-2-like protein 8; BCL2-binding component 6; bcl-2-binding component 6; BCL-X/BCL-2 binding protein; BCL2-antagonist of cell death protein; bcl-XL/Bcl-2-associated death promoter;
Gene ID 572
mRNA Refseq NM_004322
Protein Refseq NP_004313
MIM 603167
UniProt ID Q92934

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BAD Products

Required fields are marked with *

My Review for All BAD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon