Recombinant Human BAD protein, GST-tagged

• Cat.No.: BAD-048H
• Product Overview: Human BAD full-length ORF ( AAH01901.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 44.11 kDa
• AA Sequence: MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BAD BCL2-associated agonist of cell death [ Homo sapiens ]
• Official Symbol: BAD
• Synonyms: BAD; BCL2-associated agonist of cell death; bcl2 antagonist of cell death; BBC2; BCL2L8; bcl2-L-8; BCL2-binding protein; bcl-2-like protein 8; BCL2-binding component 6; bcl-2-binding component 6; BCL-X/BCL-2 binding protein; BCL2-antagonist of cell death protein; bcl-XL/Bcl-2-associated death promoter
• Gene ID: 572
• mRNA Refseq: NM_004322
• Protein Refseq: NP_004313
• MIM: 603167
• UniProt ID: Q92934