Recombinant Human BACE2, GST-tagged

• Cat.No.: BACE2-578TH
• Product Overview: Human BACE2 partial ORF (306 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer''s disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants.
• Source: Wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.64 kDa
• AA Sequence: TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLY IQPMMGAGLNYECYR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BACE2 beta-site APP-cleaving enzyme 2 [ Homo sapiens (human) ]
• Official Symbol: BACE2
• Synonyms: BACE2; ASP1; BAE2; DRAP; AEPLC; ALP56; ASP21; CDA13; CEAP1; beta-site APP-cleaving enzyme 2; beta-secretase 2; memapsin-1; theta-secretase; aspartyl protease 1; 56 kDa aspartic-like protease; Down syndrome region aspartic protease; transmembrane aspartic proteinase Asp1; membrane-associated aspartic protease 1; beta-site amyloid beta A4 precursor protein-cleaving enzyme 2; EC 3.4.23.45
• Gene ID: 25825
• mRNA Refseq: NM_012105
• Protein Refseq: NP_036237
• MIM: 605668
• UniProt ID: Q9Y5Z0
• Chromosome Location: 21q22.3
• Pathway: Alzheimer''s disease
• Function: aspartic-type endopeptidase activity