Recombinant Human B4GALT6 protein, GST-tagged

• Cat.No.: B4GALT6-32H
• Product Overview: Recombinant Human B4GALT6(48 a.a. - 145 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.52 kDa
• AA Sequence: ARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 48-145 a.a.

Gene Information

• Gene Name: B4GALT6 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 [ Homo sapiens ]
• Official Symbol: B4GALT6
• Synonyms: B4GALT6; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6; beta-1,4-galactosyltransferase 6; beta4GalT VI; UDP Gal:glucosylceramide beta 1; 4 galactosyltransferase; beta4GalT-VI; beta-1,4-GalTase 6; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6; UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6; B4Gal-T6; beta4Gal-T6
• Gene ID: 9331
• mRNA Refseq: NM_004775
• Protein Refseq: NP_004766
• MIM: 604017
• UniProt ID: Q9UBX8
• Chromosome Location: 18q11
• Pathway: Asparagine N-linked glycosylation, organism-specific biosystem; Lactosylceramide biosynthesis, organism-specific biosystem; Lactosylceramide biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan antennae elongation, organism-specific biosystem; N-glycan antennae elongation in the medial/trans-Golgi, organism-specific biosystem
• Function: UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity; galactosyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups