Recombinant Human B4GALT6 protein, GST-tagged

Cat.No. : B4GALT6-32H
Product Overview : Recombinant Human B4GALT6(48 a.a. - 145 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 48-145 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.52 kDa
AA Sequence : ARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name B4GALT6 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 [ Homo sapiens ]
Official Symbol B4GALT6
Synonyms B4GALT6; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6; beta-1,4-galactosyltransferase 6; beta4GalT VI; UDP Gal:glucosylceramide beta 1; 4 galactosyltransferase; beta4GalT-VI; beta-1,4-GalTase 6; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6; UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6; B4Gal-T6; beta4Gal-T6;
Gene ID 9331
mRNA Refseq NM_004775
Protein Refseq NP_004766
MIM 604017
UniProt ID Q9UBX8
Chromosome Location 18q11
Pathway Asparagine N-linked glycosylation, organism-specific biosystem; Lactosylceramide biosynthesis, organism-specific biosystem; Lactosylceramide biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan antennae elongation, organism-specific biosystem; N-glycan antennae elongation in the medial/trans-Golgi, organism-specific biosystem;
Function UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity; galactosyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All B4GALT6 Products

Required fields are marked with *

My Review for All B4GALT6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon