Recombinant Human B4GALT5, His-tagged

Cat.No. : B4GALT5-42H
Product Overview : Recombinant Human β-1,4-Galactosyltransferase 5/B4GALT5 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Pro36-Tyr388) of Human B4GALT5 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : β-1,4-Galactosyltransferase 5 (B4GALT5) is a single-pass type II membrane protein that belongs to the glycosyltransferase 7 family. B4GALT5 includes a cytoplasmic domain (aa 1-14), a transmembrane segment (aa 15-35), and an extracellular region (aa36 - 388). B4GALT5 is ubiquitously expressed in many tissues and required for Manganese as cofactor. The B4GALT5 function is responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.
Source : HEK293
Species : Human
Tag : His
Form : Supplied as a 0.2 μM filtered solution of 20mM HEPES, 150mM NaCl, 10% Glycerol, pH 7.5
AA Sequence : PGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTT FLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVA ILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCL IFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWG WGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN YFANITYDALYKNITVNLTPELAQVNEYVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Protein length : 36-388 a.a.
Gene Name B4GALT5 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 [ Homo sapiens ]
Official Symbol B4GALT5
Synonyms B4GALT5; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5; beta-1,4-galactosyltransferase 5; beta4 GalT IV; beta4GalT V; beta4-GalT IV; beta-1,4-GalT II; beta-1,4-GalT IV; beta-1,4-GalTase 5; beta-1.4-galactosyltransferase V; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5; gt-V; B4Gal-T5; beta4Gal-T5; beta4GalT-V; BETA4-GALT-IV; MGC138470;
Gene ID 9334
mRNA Refseq NM_004776
Protein Refseq NP_004767
MIM 604016
UniProt ID O43286
Chromosome Location 20q13.1-q13.2
Pathway Asparagine N-linked glycosylation, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; N-Glycan antennae elongation, organism-specific biosystem; N-glycan antennae elongation in the medial/trans-Golgi, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem;
Function galactosyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All B4GALT5 Products

Required fields are marked with *

My Review for All B4GALT5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon