Recombinant Human B4GALNT1 protein, GST-tagged

• Cat.No.: B4GALNT1-026H
• Product Overview: Human B4GALNT1 full-length ORF ( AAH29828.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. [provided by RefSeq]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 61.9 kDa
• AA Sequence: MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTGARPGWRDGQAGQTEKNQKGWSGQMAEGMGGIWAMARAVQPHNGCFNWTSRARGRKGAFVHLGLEQARGKPEPWVCLPFRPTVGGPRKRLV
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: B4GALNT1 beta-1,4-N-acetyl-galactosaminyl transferase 1 [ Homo sapiens ]
• Official Symbol: B4GALNT1
• Synonyms: B4GALNT1; beta-1,4-N-acetyl-galactosaminyl transferase 1; GALGT, UDP Gal:betaGlcNAc beta 1,4 N acetylgalactosaminyltransferase transferase 1 , UDP N acetyl alpha D galactosamine:(N acetylneuraminyl) galactosylglucosylceramide N acetylgalactosaminyltransferase (GalNAc T); beta-1,4 N-acetylgalactosaminyltransferase 1; beta1 4GalNAc T; GD2 synthase; GM2 synthase; GalNAc-T; beta1,4GalNAc-T; beta1-4GalNAc-T; GM2/GD2 synthase; GD2 synthase, GM2 synthase; (N-acetylneuraminyl)-galactosylglucosylceramide; UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1; UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase (GalNAc-T); GALGT; GALNACT
• Gene ID: 2583
• mRNA Refseq: NM_001478
• Protein Refseq: NP_001469
• MIM: 601873
• UniProt ID: Q00973