Recombinant Human B4GALNT1 protein, GST-tagged
Cat.No. : | B4GALNT1-026H |
Product Overview : | Human B4GALNT1 full-length ORF ( AAH29828.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 61.9 kDa |
AA Sequence : | MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTGARPGWRDGQAGQTEKNQKGWSGQMAEGMGGIWAMARAVQPHNGCFNWTSRARGRKGAFVHLGLEQARGKPEPWVCLPFRPTVGGPRKRLV |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | B4GALNT1 beta-1,4-N-acetyl-galactosaminyl transferase 1 [ Homo sapiens ] |
Official Symbol | B4GALNT1 |
Synonyms | B4GALNT1; beta-1,4-N-acetyl-galactosaminyl transferase 1; GALGT, UDP Gal:betaGlcNAc beta 1,4 N acetylgalactosaminyltransferase transferase 1 , UDP N acetyl alpha D galactosamine:(N acetylneuraminyl) galactosylglucosylceramide N acetylgalactosaminyltransferase (GalNAc T); beta-1,4 N-acetylgalactosaminyltransferase 1; beta1 4GalNAc T; GD2 synthase; GM2 synthase; GalNAc-T; beta1,4GalNAc-T; beta1-4GalNAc-T; GM2/GD2 synthase; GD2 synthase, GM2 synthase; (N-acetylneuraminyl)-galactosylglucosylceramide; UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1; UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase (GalNAc-T); GALGT; GALNACT; |
Gene ID | 2583 |
mRNA Refseq | NM_001478 |
Protein Refseq | NP_001469 |
MIM | 601873 |
UniProt ID | Q00973 |
◆ Recombinant Proteins | ||
B4GALNT1-026H | Recombinant Human B4GALNT1 protein, GST-tagged | +Inquiry |
B4GALNT1-1645HF | Recombinant Full Length Human B4GALNT1 Protein, GST-tagged | +Inquiry |
B4GALNT1-578R | Recombinant Rat B4GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
B4GALNT1-920R | Recombinant Rat B4GALNT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
B4GALNT1-2110HCL | Recombinant Human B4GALNT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B4GALNT1 Products
Required fields are marked with *
My Review for All B4GALNT1 Products
Required fields are marked with *
0
Inquiry Basket