Recombinant Human B3GNT4 protein, GST-tagged

Cat.No. : B3GNT4-022H
Product Overview : Human B3GNT4 partial ORF ( NP_110392, 279 a.a. - 378 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : GGYVMSRATVRRLQAIMEDAELFPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWALVTDEGLKCAAGPIPQR
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name B3GNT4 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [ Homo sapiens ]
Official Symbol B3GNT4
Synonyms B3GNT4; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4; B3GN T4; beta3Gn T4; BGnT-4; beta-1,3-Gn-T4; beta-1,3-N-acetylglucosaminyltransferase 4; beta-1,3-N-acetylglucosaminyltransferase bGn-T4; B3GN-T4; beta3Gn-T4;
Gene ID 79369
mRNA Refseq NM_030765
Protein Refseq NP_110392
MIM 605864
UniProt ID Q9C0J1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All B3GNT4 Products

Required fields are marked with *

My Review for All B3GNT4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon