Recombinant Human B3GALT6 protein, GST-tagged

• Cat.No.: B3GALT6-012H
• Product Overview: Human B3GALT6 partial ORF ( NP_542172, 229 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.85 kDa
• AA Sequence: RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: B3GALT6 UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 [ Homo sapiens ]
• Official Symbol: B3GALT6
• Synonyms: B3GALT6; UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6; UDP Gal:betaGlcNAc beta 1,3 galactosyltransferase, polypeptide 6; beta-1,3-galactosyltransferase 6; beta 1; 3 galactosyltransferase 6; beta3GalT6; GAG GalTII; beta3Gal-T6; beta-1,3-GalTase 6; galactosyltransferase II; galactosylxylosylprotein 3-beta-galactosyltransferase; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6
• Gene ID: 126792
• mRNA Refseq: NM_080605
• Protein Refseq: NP_542172
• UniProt ID: Q96L58