Recombinant Human B3GALT6 protein, GST-tagged

Cat.No. : B3GALT6-012H
Product Overview : Human B3GALT6 partial ORF ( NP_542172, 229 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.85 kDa
AA Sequence : RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name B3GALT6 UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 [ Homo sapiens ]
Official Symbol B3GALT6
Synonyms B3GALT6; UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6; UDP Gal:betaGlcNAc beta 1,3 galactosyltransferase, polypeptide 6; beta-1,3-galactosyltransferase 6; beta 1; 3 galactosyltransferase 6; beta3GalT6; GAG GalTII; beta3Gal-T6; beta-1,3-GalTase 6; galactosyltransferase II; galactosylxylosylprotein 3-beta-galactosyltransferase; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6;
Gene ID 126792
mRNA Refseq NM_080605
Protein Refseq NP_542172
UniProt ID Q96L58

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All B3GALT6 Products

Required fields are marked with *

My Review for All B3GALT6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon