Recombinant Human B3GALT5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: B3GALT5-1967H
• Product Overview: B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149363) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 36.2 kDa
• AA Sequence: MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: B3GALT5 beta-1,3-galactosyltransferase 5 [ Homo sapiens (human) ]
• Official Symbol: B3GALT5
• Synonyms: B3GALT5; beta-1,3-galactosyltransferase 5; B3T5; GLCT5; B3GalTx; B3GalT-V; beta3Gal-T5; beta-3-Gx-T5; beta-1,3-GalTase 5; beta-1,3-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5; homolog of C. elegans Bt toxin resistance gene bre-5; EC 2.4.1.-
• Gene ID: 10317
• mRNA Refseq: NM_033173
• Protein Refseq: NP_149363
• MIM: 604066
• UniProt ID: Q9Y2C3