Recombinant Human B2M Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: B2M-6236H
• Product Overview: B2M MS Standard C13 and N15-labeled recombinant protein (NP_004039) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13.71 kDa
• AA Sequence: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: B2M beta-2-microglobulin [ Homo sapiens (human) ]
• Official Symbol: B2M
• Synonyms: B2M; beta-2-microglobulin; beta-2-microglobin; beta chain of MHC class I molecules
• Gene ID: 567
• mRNA Refseq: NM_004048
• Protein Refseq: NP_004039
• MIM: 109700
• UniProt ID: P61769