Recombinant Human axin 1 Protein, His tagged

• Cat.No.: AXIN1-13H
• Product Overview: Recombinant Human axin 1 protein (210-410 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 210-410 aa
• Description: This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 24 kDa
• AA Sequence: MYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 80 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH 7.4, 10 % Glycerol
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: AXIN1 axin 1 [ Homo sapiens (human) ]
• Official Symbol: AXIN1
• Synonyms: AXIN1; axin 1; axin-1; PPP1R49; protein phosphatase 1; regulatory subunit 49; axis inhibitor 1; fused, mouse, homolog of; axis inhibition protein 1; protein phosphatase 1, regulatory subunit 49; AXIN; MGC52315
• Gene ID: 8312
• mRNA Refseq: NM_003502
• Protein Refseq: NP_003493
• MIM: 603816
• UniProt ID: O15169