Recombinant Human AVPR1B Full Length Transmembrane protein, His-tagged

• Cat.No.: AVPR1B-1024H
• Product Overview: Recombinant Human AVPR1B protein(P47901)(1-424aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Source: In vitro E. coli expression system
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53.0 kDa
• Protein length: 1-424aa
• AA Sequence: MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: AVPR1B arginine vasopressin receptor 1B [ Homo sapiens ]
• Official Symbol: AVPR1B
• Synonyms: AVPR1B; arginine vasopressin receptor 1B; AVPR3; vasopressin V1b receptor; V1bR; AVPR V3; AVPR V1b; vasopressin V3 receptor; arginine vasopressin receptor 3; antidiuretic hormone receptor 1B; pituitary vasopressin receptor 3
• Gene ID: 553
• mRNA Refseq: NM_000707
• Protein Refseq: NP_000698
• MIM: 600264
• UniProt ID: P47901