Recombinant Full Length Mouse Vasopressin V1B Receptor(Avpr1B) Protein, His-Tagged
Cat.No. : | RFL19031MF |
Product Overview : | Recombinant Full Length Mouse Vasopressin V1b receptor(Avpr1b) Protein (Q9WU02) (1-421aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-421) |
Form : | Lyophilized powder |
AA Sequence : | MDSEPSWTATPSPGGTLFVPNTTTPWLGRDEELAKVEIGILATVLVLATGGNLAVLLILG LQGHKRSRMHLFVLHLALTDLGVALFQVLPQLLWDITYRFQGSDLLCRAVKYLQVLSMFA STYMLLAMTLDRYLAVCHPLRSLQQPSQSTYPLIAAPWLLAAILSLPQVFIFSLREVIQG SGVLDCWADFYFSWGPRAYITWTTMAIFVLPVVVLTACYGLICHEIYKNLKVKTQAGREE RRGWPKSSSSAAAAATRGLPSRVSSISTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMW SVWDENAPNEDSTNVAFTISMLLGNLSSCCNPWIYMGFNSHLLPRSLSHRACCRGSKPRV HRQLSNSSLASRRTTLLTHTCGPSTLRLSLNLSLHAKPKPAGSLKDLEQVDGEATMETSI S |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Avpr1b |
Synonyms | Avpr1b; V1br; Vasopressin V1b receptor; V1bR; AVPR V1b; AVPR V3; Antidiuretic hormone receptor 1b; Vasopressin V3 receptor |
UniProt ID | Q9WU02 |
◆ Recombinant Proteins | ||
AVPR1B-914M | Recombinant Mouse AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR1B-563R | Recombinant Rat AVPR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
AVPR1B-1046H | Recombinant Human AVPR1B protein | +Inquiry |
AVPR1B-8465Z | Recombinant Zebrafish AVPR1B | +Inquiry |
RFL19031MF | Recombinant Full Length Mouse Vasopressin V1B Receptor(Avpr1B) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Avpr1b Products
Required fields are marked with *
My Review for All Avpr1b Products
Required fields are marked with *
0
Inquiry Basket