Recombinant Human AVEN protein, GST-tagged

• Cat.No.: AVEN-1041H
• Product Overview: Human AVEN full-length ORF ( NP_065104.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: AVEN (Apoptosis And Caspase Activation Inhibitor) is a Protein Coding gene. Diseases associated with AVEN include Schizoid Personality Disorder and Alzheimer Disease Mitochondrial. Among its related pathways are Apoptosis and Autophagy.
• Molecular Mass: 64.9 kDa
• AA Sequence: MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AVEN apoptosis, caspase activation inhibitor [ Homo sapiens ]
• Official Symbol: AVEN
• Synonyms: AVEN; apoptosis, caspase activation inhibitor; cell death regulator Aven; cell death regulator aven; PDCD12; programmed cell death 12
• Gene ID: 57099
• mRNA Refseq: NM_020371
• Protein Refseq: NP_065104
• MIM: 605265
• UniProt ID: Q9NQS1