Recombinant Human AUTS2 protein, GST-tagged

• Cat.No.: AUTS2-1040H
• Product Overview: Human AUTS2 partial ORF ( NP_056385, 108 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene has been implicated in neurodevelopment and as a candidate gene for numerous neurological disorders, including autism spectrum disorders, intellectual disability, and developmental delay. Mutations in this gene have also been associated with non-neurological disorders, such as acute lymphoblastic leukemia, aging of the skin, early-onset androgenetic alopecia, and certain cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2014]
• Molecular Mass: 35.75 kDa
• AA Sequence: LKPQERVEKRQTPLTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQLKPGQNSCRDSDSESASGESKGFH
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AUTS2 autism susceptibility candidate 2 [ Homo sapiens ]
• Official Symbol: AUTS2
• Synonyms: AUTS2; autism susceptibility candidate 2; autism susceptibility gene 2 protein; FBRSL2; KIAA0442; autism-related protein 1; MGC13140
• Gene ID: 26053
• mRNA Refseq: NM_001127231
• Protein Refseq: NP_001120703
• MIM: 607270
• UniProt ID: Q8WXX7