Recombinant Human ATXN7L4 protein, GST-tagged

• Cat.No.: ATXN7L4-1034H
• Product Overview: Human ATXN7L4 full-length ORF ( NP_689962.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ATXN7L1 (Ataxin 7 Like 1) is a Protein Coding gene. An important paralog of this gene is ATXN7.
• Molecular Mass: 42.6 kDa
• AA Sequence: MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCGRKQDNRRNEGISRSGPESSQAIEKHQV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATXN7L1 ataxin 7 like 1 [ Homo sapiens (human) ]
• Official Symbol: ATXN7L1
• Synonyms: ATXN7L1; ataxin 7 like 1; ATXN7L4; ataxin-7-like protein 1; ataxin 7-like 4; ataxin-7-like protein 4
• Gene ID: 222255
• mRNA Refseq: NM_001318229
• Protein Refseq: NP_001305158
• UniProt ID: Q9ULK2