Recombinant Human ATXN7 protein, GST-tagged

• Cat.No.: ATXN7-301504H
• Product Overview: Recombinant Human ATXN7 (170-335 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met170-Arg335
• AA Sequence: MHSSSSKPPLAVPPTSVFSFFPSLSKSKGGSASGSNRSSSGGVLSASSSSSKLLKSPKEKLQLRGNTRPMHPIQQSRVPHGRIMTPSVKVEKIHPKMDGTLLKSAVGPTCPATVSSLVKPGLNCPSIPKPTLPSPGQILNGKGLPAPPTLEKKPEDNSNNRKFLNKR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: ATXN7 ataxin 7 [ Homo sapiens ]
• Official Symbol: ATXN7
• Synonyms: ATXN7; ataxin 7; SCA7, spinocerebellar ataxia 7 (olivopontocerebellar atrophy with retinal degeneration); ataxin-7; ADCAII; OPCA3; spinocerebellar ataxia type 7 protein; SCA7; FLJ17787
• Gene ID: 6314
• mRNA Refseq: NM_000333
• Protein Refseq: NP_000324
• MIM: 607640
• UniProt ID: O15265