Recombinant Human ATXN2 Protein, His-Tagged

Cat.No. : ATXN2-01H
Product Overview : Recombinant Human ATXN2 Protein, His-tagged was expressed in E.coli cell
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene belongs to a group of genes that is associated with microsatellite-expansion diseases, a class of neurological and neuromuscular disorders caused by expansion of short stretches of repetitive DNA. The protein encoded by this gene has two globular domains near the N-terminus, one of which contains a clathrin-mediated trans-Golgi signal and an endoplasmic reticulum exit signal. The encoded cytoplasmic protein localizes to the endoplasmic reticulum and plasma membrane, is involved in endocytosis, and modulates mTOR signals, modifying ribosomal translation and mitochondrial function. The N-terminal region of the protein contains a polyglutamine tract of 14-31 residues that can be expanded in the pathogenic state to 32-200 residues. Intermediate length expansions of this tract increase susceptibility to amyotrophic lateral sclerosis, while long expansions of this tract result in spinocerebellar ataxia-2, an autosomal-dominantly inherited, neurodegenerative disorder. Genome-wide association studies indicate that loss-of-function mutations in this gene may be associated with susceptibility to type I diabetes, obesity and hypertension. Alternative splicing results in multiple transcript variants.
Source : Escherichia coli
Species : Human
Tag : His
Molecular Mass : The protein has a calculated MW of 53.13 kDa.
AA Sequence : MTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSSPACKQEKDDKEEKKDAAEQVRKSTLNPNAKEFNPRSFSQPKPSTTPTSPRPQAQPSPSMVGHQQPTPVYTQPVCFAPNMMYPVPVSPGVQPLYPIPMTPMPVNQAKTYRAVPNMPQQRQDQHHQSAMMHPASAAGPPIAATPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSHPAPSPVQHHQHQAAQLEHHHHHH
Purity : >80% by SDS-PAGE
Storage : Store it at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.5 mg/mL
Storage Buffer : PBS, 300mM NaCl, 10% glycerol, pH 7.4
Protein length : 701-1180 aa
Gene Name ATXN2 ataxin 2 [ Homo sapiens (human) ]
Official Symbol ATXN2
Synonyms ATX2; SCA2; TNRC13
Gene ID 6311
mRNA Refseq NM_001310121.1
Protein Refseq NP_001297050.1
MIM 601517
UniProt ID F8VQP2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATXN2 Products

Required fields are marked with *

My Review for All ATXN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon