Recombinant Human ATP8B4 protein, GST-tagged

• Cat.No.: ATP8B4-1017H
• Product Overview: Human ATP8B4 partial ORF ( NP_079113.2, 401 a.a. - 488 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the cation transport ATPase (P-type) family and type IV subfamily. The encoded protein is involved in phospholipid transport in the cell membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.42 kDa
• AA Sequence: IMTFKRCSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSEENSAGELI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP8B4 ATPase phospholipid transporting 8B4 (putative) [ Homo sapiens (human) ]
• Official Symbol: ATP8B4
• Synonyms: ATP8B4; ATPase phospholipid transporting 8B4 (putative); ATPIM; probable phospholipid-transporting ATPase IM; ATPase, class I, type 8B, member 4; P4-ATPase flippase complex alpha subunit ATP8B4; potential phospholipid-transporting ATPase IM; EC 3.6.3.1
• Gene ID: 79895
• mRNA Refseq: NM_024837
• Protein Refseq: NP_079113
• MIM: 609123
• UniProt ID: Q8TF62