Recombinant Human ATP8B2 protein, GST-tagged

• Cat.No.: ATP8B2-1016H
• Product Overview: Human ATP8B2 partial ORF ( NP_065185, 729 a.a. - 807 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Molecular Mass: 34.43 kDa
• AA Sequence: TEVFIVTGHTVLEVREELRKAREKMMDSSRSVGNGFTYQDKLSSSKLTSVLEAVAGEYALVINGHSLAHALEADMELEF
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP8B2 ATPase phospholipid transporting 8B2 [ Homo sapiens (human) ]
• Official Symbol: ATP8B2
• Synonyms: ATP8B2; ATPase phospholipid transporting 8B2; ATPID; phospholipid-transporting ATPase ID; 36/8-9 fusion protein with epitope for anti-lectin antibody; ATPase, aminophospholipid transporter, class I, type 8B, member 2; ATPase, class I, type 8B, member 2; P4-ATPase flippase complex alpha subunit ATP8B2; probable phospholipid-transporting ATPase ID; EC 3.6.3.1
• Gene ID: 57198
• mRNA Refseq: NM_001005855
• Protein Refseq: NP_001005855
• MIM: 605867
• UniProt ID: P98198