Recombinant Human ATP8B1 protein, GST-tagged

• Cat.No.: ATP8B1-1015H
• Product Overview: Human ATP8B1 partial ORF ( NP_005594.1, 471 a.a. - 551 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the P-type cation transport ATPase family, which belongs to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Mutations in this gene may result in progressive familial intrahepatic cholestasis type 1 and in benign recurrent intrahepatic cholestasis. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.65 kDa
• AA Sequence: INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP8B1 ATPase, aminophospholipid transporter, class I, type 8B, member 1 [ Homo sapiens ]
• Official Symbol: ATP8B1
• Synonyms: ATP8B1; ATPase, aminophospholipid transporter, class I, type 8B, member 1; ATPase, class I, type 8B, member 1 , ATPase, Class I, type 8B, member 1 , BRIC, FIC1, PFIC1; probable phospholipid-transporting ATPase IC; ATPIC; PFIC; E1-E2 ATPase; ATPase, class I, type 8B, member 1; phospholipid-transporting ATPase IC; familial intrahepatic cholestasis type 1; BRIC; FIC1; PFIC1
• Gene ID: 5205
• mRNA Refseq: NM_005603
• Protein Refseq: NP_005594
• MIM: 602397
• UniProt ID: O43520