Recombinant Human ATP8B1 protein, GST-tagged

Cat.No. : ATP8B1-1015H
Product Overview : Human ATP8B1 partial ORF ( NP_005594.1, 471 a.a. - 551 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the P-type cation transport ATPase family, which belongs to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Mutations in this gene may result in progressive familial intrahepatic cholestasis type 1 and in benign recurrent intrahepatic cholestasis. [provided by RefSeq, Jul 2008]
Molecular Mass : 34.65 kDa
AA Sequence : INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP8B1 ATPase, aminophospholipid transporter, class I, type 8B, member 1 [ Homo sapiens ]
Official Symbol ATP8B1
Synonyms ATP8B1; ATPase, aminophospholipid transporter, class I, type 8B, member 1; ATPase, class I, type 8B, member 1 , ATPase, Class I, type 8B, member 1 , BRIC, FIC1, PFIC1; probable phospholipid-transporting ATPase IC; ATPIC; PFIC; E1-E2 ATPase; ATPase, class I, type 8B, member 1; phospholipid-transporting ATPase IC; familial intrahepatic cholestasis type 1; BRIC; FIC1; PFIC1;
Gene ID 5205
mRNA Refseq NM_005603
Protein Refseq NP_005594
MIM 602397
UniProt ID O43520

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP8B1 Products

Required fields are marked with *

My Review for All ATP8B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon