Recombinant Human ATP8A2 protein, GST-tagged

• Cat.No.: ATP8A2-6755H
• Product Overview: Recombinant Human ATP8A2 protein(1085-1188 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 1085-1188 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: EDVAWRAAKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRKTPPTLFRGSSLQQGVPHGYAFSQEEHGAVSQEEVIRAYDTTKKKSRKK
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ATP8A2 ATPase, aminophospholipid transporter, class I, type 8A, member 2 [ Homo sapiens ]
• Official Symbol: ATP8A2
• Synonyms: ATP8A2; ATPase, aminophospholipid transporter, class I, type 8A, member 2; ATPase, aminophospholipid transporter like, class I, type 8A, member 2 , ATPase, aminophospholipid transporter like, Class I, type 8A, member 2; probable phospholipid-transporting ATPase IB; ATPIB; ML 1; ATPase class I type 8A member 2; ATPase, aminophospholipid transporter-like, class I, type 8A, member 2; IB; ATP; ML-1; DKFZp434B1913
• mRNA Refseq: NM_016529
• Protein Refseq: NP_057613
• MIM: 605870
• UniProt ID: Q9NTI2
• Gene ID: 51761