Recombinant Human ATP7A

Cat.No. : ATP7A-27417TH
Product Overview : Recombinant fragment corresponding to amino acids 1406-1500 of Human ATP7A with an N terminal proprietary tag; Predicted MWt 36.08 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 95 amino acids
Description : This gene encodes a transmembrane protein that functions in copper transport across membranes. This protein is localized to the trans-Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. It relocalizes to the plasma membrane under conditions of elevated extracellular copper, and functions in the efflux of copper from cells. Mutations in this gene are associated with Menkes disease, X-linked cutis laxa, and occipital horn syndrome.
Molecular Weight : 36.080kDa inclusive of tags
Tissue specificity : Found in most tissues except liver. Isoform 3 is widely expressed including in liver cell lines. Isoform 1 is expressed in fibroblasts, choriocarcinoma, colon carcinoma and neuroblastoma cell lines. Isoform 2 is expressed in fibroblasts, colon carcinoma a
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTAL
Sequence Similarities : Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IB subfamily.Contains 6 HMA domains.
Gene Name ATP7A ATPase, Cu++ transporting, alpha polypeptide [ Homo sapiens ]
Official Symbol ATP7A
Synonyms ATP7A; ATPase, Cu++ transporting, alpha polypeptide; Menkes syndrome , MNK; copper-transporting ATPase 1;
Gene ID 538
mRNA Refseq NM_000052
Protein Refseq NP_000043
MIM 300011
Uniprot ID Q04656
Chromosome Location Xq21.1
Pathway Ion channel transport, organism-specific biosystem; Ion transport by P-type ATPases, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function ATP binding; ATP binding; ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism; copper ion binding; copper ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP7A Products

Required fields are marked with *

My Review for All ATP7A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon