Recombinant Human ATP7A
Cat.No. : | ATP7A-27417TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1406-1500 of Human ATP7A with an N terminal proprietary tag; Predicted MWt 36.08 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 95 amino acids |
Description : | This gene encodes a transmembrane protein that functions in copper transport across membranes. This protein is localized to the trans-Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. It relocalizes to the plasma membrane under conditions of elevated extracellular copper, and functions in the efflux of copper from cells. Mutations in this gene are associated with Menkes disease, X-linked cutis laxa, and occipital horn syndrome. |
Molecular Weight : | 36.080kDa inclusive of tags |
Tissue specificity : | Found in most tissues except liver. Isoform 3 is widely expressed including in liver cell lines. Isoform 1 is expressed in fibroblasts, choriocarcinoma, colon carcinoma and neuroblastoma cell lines. Isoform 2 is expressed in fibroblasts, colon carcinoma a |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTAL |
Sequence Similarities : | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IB subfamily.Contains 6 HMA domains. |
Gene Name | ATP7A ATPase, Cu++ transporting, alpha polypeptide [ Homo sapiens ] |
Official Symbol | ATP7A |
Synonyms | ATP7A; ATPase, Cu++ transporting, alpha polypeptide; Menkes syndrome , MNK; copper-transporting ATPase 1; |
Gene ID | 538 |
mRNA Refseq | NM_000052 |
Protein Refseq | NP_000043 |
MIM | 300011 |
Uniprot ID | Q04656 |
Chromosome Location | Xq21.1 |
Pathway | Ion channel transport, organism-specific biosystem; Ion transport by P-type ATPases, organism-specific biosystem; Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem; |
Function | ATP binding; ATP binding; ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism; copper ion binding; copper ion binding; |
◆ Recombinant Proteins | ||
ATP7A-454H | Recombinant Human Menkes Protein, Domain 1 | +Inquiry |
ATP7A-895R | Recombinant Rat ATP7A Protein | +Inquiry |
ATP7A-455H | Recombinant Human ATP7A, Domain 2 | +Inquiry |
ATP7A-459H | Recombinant Human ATPase, Cu++ Transporting, Alpha Polypeptide | +Inquiry |
ATP7A-460H | Recombinant Human ATPase, Cu++ Transporting, Alpha Polypeptide, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP7A Products
Required fields are marked with *
My Review for All ATP7A Products
Required fields are marked with *
0
Inquiry Basket