Recombinant Human ATP6V1F protein, GST-tagged

Cat.No. : ATP6V1F-1008H
Product Overview : Human ATP6V1F full-length ORF ( NP_004222.2, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is the V1 domain F subunit protein. [provided by RefSeq, Jul 2008]
Molecular Mass : 39.8 kDa
AA Sequence : MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F [ Homo sapiens ]
Official Symbol ATP6V1F
Synonyms ATP6V1F; ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F; V-type proton ATPase subunit F; ATP6S14; VATF; Vma7; V-ATPase F subunit; V-ATPase subunit F; ATPase, vacuolar, 14 kD; V-ATPase 14 kDa subunit; vacuolar proton pump F subunit; vacuolar proton pump subunit F; vacuolar ATP synthase subunit F; adenosinetriphosphatase 14k chain; H(+)-transporting two-sector ATPase, 14kD subunit; MGC117321; MGC126037; MGC126038;
Gene ID 9296
mRNA Refseq NM_001198909
Protein Refseq NP_001185838
MIM 607160
UniProt ID Q16864

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP6V1F Products

Required fields are marked with *

My Review for All ATP6V1F Products

Required fields are marked with *

0

Inquiry Basket

cartIcon