Recombinant Human ATP6V1F protein, GST-tagged
Cat.No. : | ATP6V1F-1008H |
Product Overview : | Human ATP6V1F full-length ORF ( NP_004222.2, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is the V1 domain F subunit protein. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 39.8 kDa |
AA Sequence : | MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP6V1F ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F [ Homo sapiens ] |
Official Symbol | ATP6V1F |
Synonyms | ATP6V1F; ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F; V-type proton ATPase subunit F; ATP6S14; VATF; Vma7; V-ATPase F subunit; V-ATPase subunit F; ATPase, vacuolar, 14 kD; V-ATPase 14 kDa subunit; vacuolar proton pump F subunit; vacuolar proton pump subunit F; vacuolar ATP synthase subunit F; adenosinetriphosphatase 14k chain; H(+)-transporting two-sector ATPase, 14kD subunit; MGC117321; MGC126037; MGC126038; |
Gene ID | 9296 |
mRNA Refseq | NM_001198909 |
Protein Refseq | NP_001185838 |
MIM | 607160 |
UniProt ID | Q16864 |
◆ Recombinant Proteins | ||
ATP6V1F-882M | Recombinant Mouse ATP6V1F Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6V1F-226H | Recombinant Human ATP6V1F, GST-tagged | +Inquiry |
ATP6V1F-1008H | Recombinant Human ATP6V1F protein, GST-tagged | +Inquiry |
Atp6v1f-1774M | Recombinant Mouse Atp6v1f Protein, Myc/DDK-tagged | +Inquiry |
ATP6V1F-2166M | Recombinant Mouse ATP6V1F Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V1F-8578HCL | Recombinant Human ATP6V1F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6V1F Products
Required fields are marked with *
My Review for All ATP6V1F Products
Required fields are marked with *
0
Inquiry Basket