Recombinant Human ATP6V0C Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ATP6V0C-4978H |
Product Overview : | ATP6V0C MS Standard C13 and N15-labeled recombinant protein (NP_001685) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17. |
Molecular Mass : | 15.7 kDa |
AA Sequence : | MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ATP6V0C ATPase H+ transporting V0 subunit c [ Homo sapiens (human) ] |
Official Symbol | ATP6V0C |
Synonyms | ATP6V0C; ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c; ATP6C, ATP6L, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD, ATPL; V-type proton ATPase 16 kDa proteolipid subunit; VATL; Vma3; V-ATPase 16 kDa proteolipid subunit; vacuolar H+ ATPase proton channel subunit; vacuolar proton pump 16 kDa proteolipid subunit; vacuolar ATP synthase 16 kDa proteolipid subunit; H(+)-transporting two-sector ATPase, 16 kDa subunit; ATPL; VPPC; ATP6C; ATP6L; |
Gene ID | 527 |
mRNA Refseq | NM_001694 |
Protein Refseq | NP_001685 |
MIM | 108745 |
UniProt ID | P27449 |
◆ Recombinant Proteins | ||
ATP6V0C-5306C | Recombinant Chicken ATP6V0C | +Inquiry |
Atp6v0c-678M | Recombinant Mouse Atp6v0c Protein, MYC/DDK-tagged | +Inquiry |
ATP6V0C-405H | Recombinant Human ATP6V0C Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6V0C-886R | Recombinant Rat ATP6V0C Protein | +Inquiry |
ATP6V0C-2129HFL | Recombinant Full Length Human ATP6V0C Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V0C-8589HCL | Recombinant Human ATP6V0C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6V0C Products
Required fields are marked with *
My Review for All ATP6V0C Products
Required fields are marked with *
0
Inquiry Basket