Recombinant Human ATP6AP2 protein, His-tagged

• Cat.No.: ATP6AP2-2572H
• Product Overview: Recombinant Human ATP6AP2 protein(O75787)(17-350aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 17-350aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 41.5 kDa
• AA Sequence: NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ATP6AP2 ATPase, H+ transporting, lysosomal accessory protein 2 [ Homo sapiens ]
• Official Symbol: ATP6AP2
• Synonyms: ATP6AP2; ATPase, H+ transporting, lysosomal accessory protein 2; ATP6IP2, ATPase, H+ transporting, lysosomal interacting protein 2; renin receptor; APT6M8 9; ATP6M8 9; M8 9; N14F; V-ATPase M8.9 subunit; renin/prorenin receptor; ER-localized type I transmembrane adaptor; embryonic liver differentiation factor 10; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase, H+ transporting, lysosomal interacting protein 2; vacuolar ATP synthase membrane sector-associated protein M8-9; vacuolar proton ATP synthase membrane sector associated protein M8-9; ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9; M8-9; MRXE; XMRE; HT028; ELDF10; ATP6IP2; MSTP009; APT6M8-9; ATP6M8-9; MGC99577
• Gene ID: 10159
• mRNA Refseq: NM_005765
• Protein Refseq: NP_005756
• MIM: 300556
• UniProt ID: O75787