Recombinant Human ATP6AP2 protein, GST-tagged

• Cat.No.: ATP6AP2-993H
• Product Overview: Human ATP6AP2 full-length ORF ( NP_005756.2, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases. [provided by RefSeq, Jul 2008]
• Molecular Mass: 65.4 kDa
• AA Sequence: MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP6AP2 ATPase, H+ transporting, lysosomal accessory protein 2 [ Homo sapiens ]
• Official Symbol: ATP6AP2
• Synonyms: ATP6AP2; ATPase, H+ transporting, lysosomal accessory protein 2; ATP6IP2, ATPase, H+ transporting, lysosomal interacting protein 2; renin receptor; APT6M8 9; ATP6M8 9; M8 9; N14F; V-ATPase M8.9 subunit; renin/prorenin receptor; ER-localized type I transmembrane adaptor; embryonic liver differentiation factor 10; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase, H+ transporting, lysosomal interacting protein 2; vacuolar ATP synthase membrane sector-associated protein M8-9; vacuolar proton ATP synthase membrane sector associated protein M8-9; ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9; M8-9; MRXE; XMRE; HT028; ELDF10; ATP6IP2; MSTP009; APT6M8-9; ATP6M8-9; MGC99577
• Gene ID: 10159
• mRNA Refseq: NM_005765
• Protein Refseq: NP_005756
• MIM: 300556
• UniProt ID: O75787