Recombinant Human ATP5I protein, GST-tagged

• Cat.No.: ATP5I-986H
• Product Overview: Human ATP5I full-length ORF ( AAH03679, 1 a.a. - 69 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the e subunit of the Fo complex. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jun 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33.33 kDa
• AA Sequence: MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP5I ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E [ Homo sapiens ]
• Official Symbol: ATP5I
• Synonyms: ATP5I; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit e , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E; ATP synthase subunit e, mitochondrial; ATPase subunit e; ATP synthase e chain, mitochondrial; F1F0-ATP synthase, murine e subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E; ATP5K; MGC12532
• Gene ID: 521
• mRNA Refseq: NM_007100
• Protein Refseq: NP_009031
• MIM: 601519
• UniProt ID: P56385