Recombinant Human ATP5H protein, His-tagged
Cat.No. : | ATP5H-3744H |
Product Overview : | Recombinant Human ATP5H protein(1-137 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-137 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d [ Homo sapiens ] |
Official Symbol | ATP5H |
Synonyms | ATP5H; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d; ATP synthase subunit d, mitochondrial; ATP5JD; ATPQ; My032 protein; ATPase subunit d; ATP synthase D chain, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1F0, subunit d; |
Gene ID | 10476 |
mRNA Refseq | NM_001003785 |
Protein Refseq | NP_001003785 |
UniProt ID | O75947 |
◆ Recombinant Proteins | ||
ATP5H-10023H | Recombinant Human ATP5H, GST-tagged | +Inquiry |
ATP5H-288R | Recombinant Rhesus Macaque ATP5H Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP5H-531R | Recombinant Rat ATP5H Protein, His (Fc)-Avi-tagged | +Inquiry |
Atp5h-1770M | Recombinant Mouse Atp5h Protein, Myc/DDK-tagged | +Inquiry |
ATP5H-875R | Recombinant Rat ATP5H Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5H-8599HCL | Recombinant Human ATP5H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP5H Products
Required fields are marked with *
My Review for All ATP5H Products
Required fields are marked with *
0
Inquiry Basket