Recombinant Human ATP5H protein, GST-tagged
Cat.No. : | ATP5H-2570H |
Product Overview : | Recombinant Human ATP5H protein(O75947)(1-161aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.4 kDa |
Protein length : | 1-161aa |
AA Sequence : | AGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d [ Homo sapiens ] |
Official Symbol | ATP5H |
Synonyms | ATP5H; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d; ATP synthase subunit d, mitochondrial; ATP5JD; ATPQ; My032 protein; ATPase subunit d; ATP synthase D chain, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1F0, subunit d; |
Gene ID | 10476 |
mRNA Refseq | NM_001003785 |
Protein Refseq | NP_001003785 |
UniProt ID | O75947 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATP5H Products
Required fields are marked with *
My Review for All ATP5H Products
Required fields are marked with *
0
Inquiry Basket