Recombinant Human ATP5H protein, GST-tagged

• Cat.No.: ATP5H-985H
• Product Overview: Human ATP5H full-length ORF ( NP_006347.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15. [provided by RefSeq, Jun 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44.9 kDa
• AA Sequence: MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d [ Homo sapiens ]
• Official Symbol: ATP5H
• Synonyms: ATP5H; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d; ATP synthase subunit d, mitochondrial; ATP5JD; ATPQ; My032 protein; ATPase subunit d; ATP synthase D chain, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1F0, subunit d
• Gene ID: 10476
• mRNA Refseq: NM_001003785
• Protein Refseq: NP_001003785
• UniProt ID: O75947