Recombinant Human ATP5F1, His-tagged

• Cat.No.: ATP5F1-37H
• Product Overview: Recombinant Human ATP Synthase Subunit B Mitochondrial/ATP5F1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro43-Met256) of Human ATP5F1 fused with a polyhistidine tag at the C-terminus.

Specification

• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: PVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLG VMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRN NIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIA KCIADLKLLAKKAQAQPVMVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Protein length: 43-256 a.a.

Gene Information

• Gene Name: ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 [ Homo sapiens ]
• Official Symbol: ATP5F1
• Synonyms: ATP5F1; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase subunit b, mitochondrial; ATPase subunit b; H+-ATP synthase subunit b; ATP synthase B chain, mitochondrial; cell proliferation-inducing protein 47; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1; PIG47; MGC24431
• Gene ID: 515
• mRNA Refseq: NM_001688
• Protein Refseq: NP_001679
• MIM: 603270
• UniProt ID: P24539
• Chromosome Location: 1p13.2
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem
• Function: contributes_to ATPase activity; hydrogen ion transmembrane transporter activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; protein binding; transmembrane transporter activity