Recombinant Human ATP5F1, His-tagged

Cat.No. : ATP5F1-37H
Product Overview : Recombinant Human ATP Synthase Subunit B Mitochondrial/ATP5F1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro43-Met256) of Human ATP5F1 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 43-256 a.a.
AA Sequence : PVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLG VMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRN NIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIA KCIADLKLLAKKAQAQPVMVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 [ Homo sapiens ]
Official Symbol ATP5F1
Synonyms ATP5F1; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase subunit b, mitochondrial; ATPase subunit b; H+-ATP synthase subunit b; ATP synthase B chain, mitochondrial; cell proliferation-inducing protein 47; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1; PIG47; MGC24431;
Gene ID 515
mRNA Refseq NM_001688
Protein Refseq NP_001679
MIM 603270
UniProt ID P24539
Chromosome Location 1p13.2
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function contributes_to ATPase activity; hydrogen ion transmembrane transporter activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; protein binding; transmembrane transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP5F1 Products

Required fields are marked with *

My Review for All ATP5F1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon