Recombinant Human ATP2A3 protein, GST-tagged

• Cat.No.: ATP2A3-971H
• Product Overview: Human ATP2A3 partial ORF ( AAH35729, 501 a.a. - 620 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Molecular Mass: 38.94 kDa
• AA Sequence: TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP2A3 ATPase, Ca++ transporting, ubiquitous [ Homo sapiens ]
• Official Symbol: ATP2A3
• Synonyms: ATP2A3; ATPase, Ca++ transporting, ubiquitous; sarcoplasmic/endoplasmic reticulum calcium ATPase 3; SERCA3; calcium pump 3; SR Ca(2+)-ATPase 3; adenosine triphosphatase, calcium; calcium-translocating P-type ATPase; ATPase, Ca(2+)-transporting, ubiquitous; sarco/endoplasmic reticulum Ca2+ -ATPase
• Gene ID: 489
• mRNA Refseq: NM_005173
• Protein Refseq: NP_005164
• MIM: 601929
• UniProt ID: Q93084