Recombinant Human ATP13A2 protein, GST-tagged

• Cat.No.: ATP13A2-962H
• Product Overview: Human ATP13A2 partial ORF ( NP_071372, 68 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the P5 subfamily of ATPases which transports inorganic cations as well as other substrates. Mutations in this gene are associated with Kufor-Rakeb syndrome (KRS), also referred to as Parkinson disease 9. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.31 kDa
• AA Sequence: KPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEA
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP13A2 ATPase type 13A2 [ Homo sapiens ]
• Official Symbol: ATP13A2
• Synonyms: ATP13A2; ATPase type 13A2; PARK9, Parkinson disease (autosomal recessive) 9 (Kufor Rakeb syndrome); probable cation-transporting ATPase 13A2; CLN12; HSA9947; putative ATPase; KRPPD; PARK9; RP1-37C10.4; FLJ26510
• Gene ID: 23400
• mRNA Refseq: NM_001141973
• Protein Refseq: NP_001135445
• MIM: 610513
• UniProt ID: Q9NQ11