Recombinant Human ATP11C protein, GST-tagged
Cat.No. : | ATP11C-960H |
Product Overview : | Human ATP11C partial ORF ( NP_775965, 441 a.a. - 545 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | ATP11C (ATPase Phospholipid Transporting 11C) is a Protein Coding gene. Among its related pathways are Ion channel transport and Cardiac conduction. GO annotations related to this gene include nucleotide binding and cation-transporting ATPase activity. An important paralog of this gene is ATP11A. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 37.29 kDa |
AA Sequence : | VDGLSQTDGTLTYFDKVDKNREELFLRALCLCHTVEIKTNDAVDGATESAELTYISSSPDEIALVKGAKRYGFTFLGNRNGYMRVENQRKEIEEYELLHTLNFDA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP11C ATPase, class VI, type 11C [ Homo sapiens ] |
Official Symbol | ATP11C |
Synonyms | ATP11C; ATPase, class VI, type 11C; ATPase, Class VI, type 11C; probable phospholipid-transporting ATPase IG; ATPIG; ATPIQ; phospholipid-transporting ATPase IG; |
Gene ID | 286410 |
mRNA Refseq | NM_001010986 |
Protein Refseq | NP_001010986 |
MIM | 300516 |
UniProt ID | Q8NB49 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATP11C Products
Required fields are marked with *
My Review for All ATP11C Products
Required fields are marked with *
0
Inquiry Basket