Recombinant Human ATOX1 protein, GST-tagged

• Cat.No.: ATOX1-958H
• Product Overview: Human ATOX1 full-length ORF ( ADR82784.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 7.5 kDa
• AA Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ]
• Official Symbol: ATOX1
• Synonyms: ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1; metal transport protein ATX1; ATX1; MGC138453; MGC138455
• Gene ID: 475
• mRNA Refseq: NM_004045
• Protein Refseq: NP_004036
• MIM: 602270
• UniProt ID: O00244