Recombinant Human ATOX1

• Cat.No.: ATOX1-26679TH
• Product Overview: Recombinant Full Length Human ATOX1 produced in Saccharomyces cerevisiae; amino acids 1-68 with 26 kDa tag. Molecular weight with tag is 34 kDa.

Specification

• Description: This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKV CIESEHSMDTLLATLKKTGKTVSYLGLE
• Sequence Similarities: Belongs to the ATX1 family.Contains 1 HMA domain.
• Tag: Non
• Protein length: 1-68 a.a.
• Full Length: Full L.

Gene Information

• Gene Name: ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ]
• Official Symbol: ATOX1
• Synonyms: ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1
• Gene ID: 475
• mRNA Refseq: NM_004045
• Protein Refseq: NP_004036
• MIM: 602270
• Uniprot ID: O00244
• Chromosome Location: 5q32
• Pathway: Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem
• Function: copper chaperone activity; copper ion binding; copper-dependent protein binding; metal ion binding; metallochaperone activity