Recombinant Human ATOH7 protein, GST-tagged

• Cat.No.: ATOH7-956H
• Product Overview: Human ATOH7 full-length ORF (AAH32621.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This intronless gene encodes a member of the basic helix-loop-helix family of transcription factors, with similarity to Drosophila atonal gene that controls photoreceptor development. Studies in mice suggest that this gene plays a central role in retinal ganglion cell and optic nerve formation. Mutations in this gene are associated with nonsyndromic congenital retinal nonattachment. [provided by RefSeq, Dec 2011]
• Molecular Mass: 43.12 kDa
• AA Sequence: MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATOH7 atonal homolog 7 (Drosophila) [ Homo sapiens ]
• Official Symbol: ATOH7
• Synonyms: ATOH7; atonal homolog 7 (Drosophila); protein atonal homolog 7; bHLHa13; Math5; hATH5; helix-loop-helix protein hATH-5; class A basic helix-loop-helix protein 13
• Gene ID: 220202
• mRNA Refseq: NM_145178
• Protein Refseq: NP_660161
• MIM: 609875
• UniProt ID: Q8N100