Recombinant Human ATG4D protein, GST-tagged

• Cat.No.: ATG4D-431H
• Product Overview: Recombinant Human ATG4D(1 a.a. - 141 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 141 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 42.4 kDa
• AA Sequence: MGGKPRHSLYFIGYQDDFLLYLDPHYCQPTVDVSQADFPLESFHCTSPRKMAFAKMDPSCTVGFYAGDRKEFETL CSELTRVLSSSSATERYPMFTLAEGHAQDHSLDDLCSQLAQPTLRLPRTGRLLRAKRPSSEDFVFL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG4D
• Synonyms: ATG4D; ATG4 autophagy related 4 homolog D (S. cerevisiae); APG4 autophagy 4 homolog D (S. cerevisiae) , APG4D, AUT like 4, cysteine endopeptidase (S. cerevisiae) , AUTL4; cysteine protease ATG4D; APG4 D; autophagin-4; APG4 autophagy 4 homolog D; AUT-like 4 cysteine endopeptidase; AUT-like 4, cysteine endopeptidase; autophagy-related protein 4 homolog D; cysteine protease involved in autophagy; autophagy-related cysteine endopeptidase 4; APG4D; AUTL4; APG4-D
• Gene ID: 84971
• mRNA Refseq: NM_032885
• Protein Refseq: NP_116274
• MIM: 611340
• UniProt ID: Q86TL0
• Chromosome Location: 19p13.2
• Pathway: Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem
• Function: cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity